PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG369100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 426aa    MW: 45480.6 Da    PI: 6.9865
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG369100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS268.62e-82324232374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lLl+cA a++s+d +laq++++ l+++as++gdp+qRl++ +++AL ar  r +   + a ++ + ++++ + +++ l  +++v+P++
  Pavir.3KG369100.1.p  32 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPNQRLTSWLLRALVARACRLCGPAAGAPQAAAPAPRERAMSVTELAEYVDVTPWH 121
                          699***************************************************7777776666666665555555555556******** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfef 178
                          +f++ + N aIl+av+g+ +vH++D++++ G+QWp+L++ L++Rp+gpp lRiT+ ++  ++        ee+g rLa+fA++ gv++ef
  Pavir.3KG369100.1.p 122 RFGFTASNGAILRAVAGSAAVHVVDLGVTRGMQWPTLIDMLSKRPGGPPALRITVPSARPAVpplLGVPDEELGARLANFAKSKGVQLEF 211
                          ******************************************************99996666877777789******************* PP

                 GRAS 179 nvl......................vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                          nv+                        ++l+++  ++ +L+++ gEal+Vn++  + ++       +  rd++L +v++l+P +v+v+++
  Pavir.3KG369100.1.p 212 NVVrkgtgtstsptsspkkkqapplCQQDLASVlsDPPSLALRDGEALVVNCQSWVRHVA------QGSRDAFLGTVRELKPCLVTVTDE 295
                          ******9999999999988888775444666556789999**************999997......445899****************** PP

                 GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                          +ad++s+s++ r+  ++++++ lfd+l++++pr+s  r+  E++ +gr+i+ vv +  a+  er e+ ++  er+++ GF+ v+++e+aa
  Pavir.3KG369100.1.p 296 DADLDSPSLASRIEGCFNFHWILFDALDTSAPRDSPRRVEHEAA-VGRKIEGVVGADDADGAERSESGARLAERMRRNGFTGVAFDEEAA 384
                          *****************************************999.********************************************* PP

                 GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           ++++ll++++  g+ v+ e++ lvl+Wk++  v + aW+
  Pavir.3KG369100.1.p 385 GEVRRLLSEHA-TGWGVKREEDMLVLTWKGHGAVYTGAWT 423
                          ***********.99*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.3565404IPR005202Transcription factor GRAS
PfamPF035146.9E-8032423IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MEQELRTGGL RVRAHSSSVC FSGALIDGPR IQQLLLHCAA ALESNDVTLA QQAMWVLNNI  60
ASSQGDPNQR LTSWLLRALV ARACRLCGPA AGAPQAAAPA PRERAMSVTE LAEYVDVTPW  120
HRFGFTASNG AILRAVAGSA AVHVVDLGVT RGMQWPTLID MLSKRPGGPP ALRITVPSAR  180
PAVPPLLGVP DEELGARLAN FAKSKGVQLE FNVVRKGTGT STSPTSSPKK KQAPPLCQQD  240
LASVLSDPPS LALRDGEALV VNCQSWVRHV AQGSRDAFLG TVRELKPCLV TVTDEDADLD  300
SPSLASRIEG CFNFHWILFD ALDTSAPRDS PRRVEHEAAV GRKIEGVVGA DDADGAERSE  360
SGARLAERMR RNGFTGVAFD EEAAGEVRRL LSEHATGWGV KREEDMLVLT WKGHGAVYTG  420
AWTPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-31314224374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270020.0KJ727002.1 Zea mays clone pUT3978 GRAS transcription factor (GRAS62) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961603.10.0PREDICTED: scarecrow-like protein 32
TrEMBLK3Z6E80.0K3Z6E8_SETIT; Uncharacterized protein
STRINGSi022117m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.13e-98GRAS family protein